Structure of PDB 5g4c Chain A

Receptor sequence

>5g4cA (length=289) Species: 9606 (Homo sapiens)

QKERLLDELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPTGLY
DNLEKYHLPYPEAIFEISYFKKHPEPFFALAKELYPGQFKPTICHYFMRL
LKDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEY
PLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKV
DLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQGGMDFDSKKAYR
DVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQ

3D structure

• PDB: 5g4c SIRT2 Reverses 4-Oxononanoyl Lysine Modification on Histones.
• Chain: A
• Resolution: 2.1 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): P94 D95 F96 R97 N168 D170 H187
• Catalytic site (residue number reindexed from 1): P41 D42 F43 R44 N114 D116 H133
• Enzyme Commision number: 2.3.1.-
  2.3.1.286: protein acetyllysine N-acetyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	F96 F119 H187 I232 V233 F235 E237 L239 V266 Q267	F43 F65 H133 I178 V179 F181 E183 L185 V212 Q213
BS02	ZN	A	C195 C200 C221 C224	C141 C146 C167 C170
BS03	CNA	A	G84 A85 G86 T89 P94 D95 F96 R97 Q167 N168 I169 D170 H187 G261 T262 S263 N286 K287 E288 E323 C324	G31 A32 G33 T36 P41 D42 F43 R44 Q113 N114 I115 D116 H133 G207 T208 S209 N232 K233 E234 E257 C258

Gene Ontology

Molecular Function

• GO:0017136 NAD-dependent histone deacetylase activity
• GO:0051287 NAD binding
• GO:0070403 NAD+ binding

External links

• PDB: RCSB:5g4c, PDBe:5g4c, PDBj:5g4c
• PDBsum: 5g4c
• PubMed: 27610633
• UniProt: Q8IXJ6|SIR2_HUMAN NAD-dependent protein deacetylase sirtuin-2 (Gene Name=SIRT2)