Structure of PDB 5g40 Chain A

Receptor sequence
>5g40A (length=215) Species: 32630 (synthetic construct) [Search protein sequence]
MNLVLMGLPGAGKGTQAEKIVEKYGIPHISTGDMFRAAIKEGTELGLKAK
SFMDKGELVPDEVTIGIVRERLSKDDCKKGFLLDGFPRTVAQAEALDNIL
SELGKKLDYVINIEVPKEELMERLTGRRICKTCGATYHLIFNPPKVEGIC
DKDGGELYQRADDNPETVANRLDVNMKQTQPLLDFYEEKGVLRNIDGQQD
INKVFADIKALLGGL
3D structure
PDB5g40 Evolutionary drivers of thermoadaptation in enzyme catalysis.
ChainA
Resolution1.69 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A C130 C133 C150 D153 C130 C133 C150 D153
BS02 ADP A G10 G12 K13 G14 T15 R123 R127 T136 Y137 H138 F141 I201 G10 G12 K13 G14 T15 R123 R127 T136 Y137 H138 F141 I201
BS03 AMP A T31 G32 F35 R36 M53 E57 V59 T64 G85 R88 Q92 R160 T31 G32 F35 R36 M53 E57 V59 T64 G85 R88 Q92 R160
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 30 23:06:48 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5g40', asym_id = 'A', title = 'Evolutionary drivers of thermoadaptation in enzyme catalysis.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5g40', asym_id='A', title='Evolutionary drivers of thermoadaptation in enzyme catalysis.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0004017,0005524,0006139,0016776,0019205', uniprot = '', pdbid = '5g40', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004017,0005524,0006139,0016776,0019205', uniprot='', pdbid='5g40', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>