Structure of PDB 5g3z Chain A

Receptor sequence

>5g3zA (length=215) Species: 32630 (synthetic construct)

MNLVLMGLPGAGKGTQAEKIVEKYGIPHISTGDMFRAAIKEGTELGLKAK
SFMDKGELVPDEVTIGIVRERLSKDDCKKGFLLDGFPRTVAQAEALDNIL
KELGKKLDYVINIEVPKEELMERLTGRRICKTCGATYHLIFNPPKVEGVC
DKCGGELYQRADDNEETVANRLDVNMKQTQPLLDFYEEKGYLRNIDGQQD
INKVFADIDALLGGL

3D structure

• PDB: 5g3z Evolutionary drivers of thermoadaptation in enzyme catalysis.
• Chain: A
• Resolution: 1.89 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	C130 C133 C150 C153	C130 C133 C150 C153
BS02	AP5	A	P9 G10 G12 K13 G14 T15 T31 R36 M53 E57 V59 T64 G85 R88 Q92 R123 R127 T136 Y137 H138 F141 R160 R171 I201	P9 G10 G12 K13 G14 T15 T31 R36 M53 E57 V59 T64 G85 R88 Q92 R123 R127 T136 Y137 H138 F141 R160 R171 I201

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 15 20:06:24 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5g3z', asym_id = 'A', title = 'Evolutionary drivers of thermoadaptation in enzyme catalysis.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5g3z', asym_id='A', title='Evolutionary drivers of thermoadaptation in enzyme catalysis.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0004017,0005524,0006139,0016776,0019205', uniprot = '', pdbid = '5g3z', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004017,0005524,0006139,0016776,0019205', uniprot='', pdbid='5g3z', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>