Structure of PDB 5g3y Chain A

Receptor sequence

>5g3yA (length=213) Species: 32630 (synthetic construct)

MNLILLGPPGAGKGTQAEKIVEEYGIPHISTGDMFRAAIKEGTELGLKAK
EYMDKGELVPDEVTIGLVKERLSQPDCKKGFLLDGFPRTVAQAEALDKIL
KELGIKLDAVINIEVPREELLERLTGRRVCRQCGATYHVIFNPPKVEGVC
DKCGGELYQRSDDNEETVSNRLDVYEDQTAPLIDYYEKKGLLKNIDGDQD
IDAVFADIKAALG

3D structure

• PDB: 5g3y Evolutionary drivers of thermoadaptation in enzyme catalysis.
• Chain: A
• Resolution: 1.18 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	C130 C133 C150 C153	C130 C133 C150 C153
BS02	ADP	A	G10 G12 K13 G14 T15 R123 R127 T136 Y137 H138 F141 I201	G10 G12 K13 G14 T15 R123 R127 T136 Y137 H138 F141 I201
BS03	ADP	A	P9 T31 G32 R36 M53 E57 L58 V59 T64 G85 R88 Q92 R127 R160	P9 T31 G32 R36 M53 E57 L58 V59 T64 G85 R88 Q92 R127 R160

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Nov 24 05:21:44 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5g3y', asym_id = 'A', title = 'Evolutionary drivers of thermoadaptation in enzyme catalysis.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5g3y', asym_id='A', title='Evolutionary drivers of thermoadaptation in enzyme catalysis.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0004017,0005524,0006139,0016776,0019205', uniprot = '', pdbid = '5g3y', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004017,0005524,0006139,0016776,0019205', uniprot='', pdbid='5g3y', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>