Structure of PDB 5g22 Chain A

Receptor sequence

>5g22A (length=385) Species: 5855 (Plasmodium vivax)

IDYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYV
CDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTW
HIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLA
PVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIG
FSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQF
NLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGND
KYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSV
FEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL

3D structure

• PDB: 5g22 Structure-guided optimization of quinoline inhibitors of Plasmodium N-myristoyltransferase.
• Chain: A
• Resolution: 2.32 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): N161 F162 L163 T197 L410
• Catalytic site (residue number reindexed from 1): N136 F137 L138 T172 L385
• Enzyme Commision number: 2.3.1.97: glycylpeptide N-tetradecanoyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NHW	A	Y28 F30 W31 Y95 V96 L163 C164 V165 R170 S171 R173 A175 I179 T183 I186 W192 A194 Y196 T197 A198 L202 Y393	Y3 F5 W6 Y70 V71 L138 C139 V140 R145 S146 R148 A150 I154 T158 I161 W167 A169 Y171 T172 A173 L177 Y368
BS02	YN4	A	E97 D98 F103 F105 Y211 H213 F226 S319 L330 Y334 L388 L410	E72 D73 F78 F80 Y186 H188 F201 S294 L305 Y309 L363 L385	MOAD: Ki=0.1uM PDBbind-CN: -logKd/Ki=7.00,Ki=0.1uM
BS03	MG	A	K172 L174	K147 L149

Gene Ontology

Molecular Function

• GO:0004379 glycylpeptide N-tetradecanoyltransferase activity
• GO:0016746 acyltransferase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006499 N-terminal protein myristoylation
• GO:0018008 N-terminal peptidyl-glycine N-myristoylation

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:5g22, PDBe:5g22, PDBj:5g22
• PDBsum: 5g22
• PubMed: 28626547
• UniProt: A5K1A2