Structure of PDB 5g1x Chain A

Receptor sequence

>5g1xA (length=263) Species: 9606 (Homo sapiens)

QWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEH
QLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLS
KFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFG
WSVHAPSSRRTTLAGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGK
PPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRLLKHNPSQRPMLRE
VLEHPWITANSSK

3D structure

• PDB: 5g1x Structural Basis of N-Myc Binding by Aurora-A and its Destabilization by Kinase Inhibitors
• Chain: A
• Resolution: 1.72 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D256 K258 E260 N261 D274 T292
• Catalytic site (residue number reindexed from 1): D130 K132 E134 N135 D148 T166
• Enzyme Commision number: 2.7.11.1: non-specific serine/threonine protein kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	K143 A172 G173 H176 W277 H280 R286 T288 L289 G291 L293 L296 T333 Y334 Q335 Y338	K17 A46 G47 H50 W151 H154 R160 T162 L163 G165 L167 L170 T207 Y208 Q209 Y212
BS02	ADP	A	G140 G142 V147 A160 K162 A213 T217 E260 L263 D274	G14 G16 V21 A34 K36 A87 T91 E134 L137 D148
BS03	MG	A	N261 D274	N135 D148

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0005524 ATP binding

Biological Process

• GO:0000212 meiotic spindle organization
• GO:0000226 microtubule cytoskeleton organization
• GO:0000278 mitotic cell cycle
• GO:0006468 protein phosphorylation
• GO:0007052 mitotic spindle organization
• GO:0007098 centrosome cycle
• GO:0007100 mitotic centrosome separation
• GO:0051321 meiotic cell cycle

External links

• PDB: RCSB:5g1x, PDBe:5g1x, PDBj:5g1x
• PDBsum: 5g1x
• PubMed: 27837025
• UniProt: O14965|AURKA_HUMAN Aurora kinase A (Gene Name=AURKA)