Structure of PDB 5fqn Chain A

Receptor sequence
>5fqnA (length=322) Species: 10090 (Mus musculus) [Search protein sequence]
LYYECDVSVHEEMIADQVRTEAYRLGILKNWAALRGKTVLDVGAGTGILS
IFCAQAGARRVYAVEASAIWQQAREVVRLNGLEDRVHVLPGPVETVELPE
RVDAIVSEWMGYGLLHESMLSSVLHARTKWLKEGGLLLPASAELFVAPIS
DQMLEWRLGFWSQVKQHYGVDMSCMESFATRCLMGHSEIVVQDLSGEDVL
ARPQRFAQLELARAGLEQELEAGVGGRFRCSCYGSAPLHGFAVWFQVTFP
GPLVLSTSPLHPATHWKQALLYLNEPVPVEQDTDISGEITLLPSPDNPRR
LRILLRYKVGDHEEKTKDFAME
3D structure
PDB5fqn Crystal Strcutures of Prmt6 in Complex with Sah in Alternative Conformations
ChainA
Resolution1.657 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) D66 E158 E167 H320
Catalytic site (residue number reindexed from 1) D16 E108 E117 H265
Enzyme Commision number 2.1.1.319: type I protein arginine methyltransferase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SAH A M63 R69 G93 A94 L99 E115 A116 P142 V143 E144 E158 M169 S172 M13 R19 G43 A44 L49 E65 A66 P92 V93 E94 E108 M119 S122
Gene Ontology
Molecular Function
GO:0003682 chromatin binding
GO:0005515 protein binding
GO:0008168 methyltransferase activity
GO:0008469 histone arginine N-methyltransferase activity
GO:0016274 protein-arginine N-methyltransferase activity
GO:0035241 protein-arginine omega-N monomethyltransferase activity
GO:0035242 protein-arginine omega-N asymmetric methyltransferase activity
GO:0042054 histone methyltransferase activity
GO:0042393 histone binding
GO:0044020 histone H4R3 methyltransferase activity
GO:0070611 histone H3R2 methyltransferase activity
GO:0070612 histone H2AR3 methyltransferase activity
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006281 DNA repair
GO:0006325 chromatin organization
GO:0006338 chromatin remodeling
GO:0010821 regulation of mitochondrion organization
GO:0018216 peptidyl-arginine methylation
GO:0032259 methylation
GO:0036211 protein modification process
GO:0045892 negative regulation of DNA-templated transcription
GO:0090398 cellular senescence
GO:1901796 regulation of signal transduction by p53 class mediator
GO:2000059 negative regulation of ubiquitin-dependent protein catabolic process
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5fqn, PDBe:5fqn, PDBj:5fqn
PDBsum5fqn
PubMed
UniProtQ6NZB1|ANM6_MOUSE Protein arginine N-methyltransferase 6 (Gene Name=Prmt6)

[Back to BioLiP]