Structure of PDB 5fhe Chain A

Receptor sequence

>5fheA (length=426)

DMILTEEMQKIMNLIQENNVFVTGKAGSGKTTFLKYLIEKSGKNCIVAAP
TGIAAINAGGVTLHSLFGIPFGPITPYDRLENKFSEYKVELLLKMELLII
DEISMVRPDILDTIDRKLRWVYESDEPFGGVQVVMFGDLFQLPPVTKKQE
REILSDFYDGFFFFNALVFKRTGFHIVELTKIFRQTEPEFINVLNNIRNY
QVTSDELDLLSELKDRKISSSNEYIHICTHKADVEKINADKLGEQEIRNY
DIVIKDKFPESSIPCDLHLKLRVGARVMSLVNDSLKGYYNGMLGIVTALE
DNVITVRMDNGRTIKFERYTWSNTQYTLKDNEIVKEEIGSCTQFPLTLAW
AITIHKSQGLTFDKIIIHVSHTFCPGQLYVALSRCRTLEGIVSDAFITKQ
MIIPEYALIDFERAYKSEGNYYGKRL

3D structure

• PDB: 5fhe Structural and Functional Insights into the Unwinding Mechanism of Bacteroides sp Pif1
• Chain: A
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	P54 T55 T66 H68 S69 G72 I73 P74 F75 N86 V149 H236 K237 T359 H361 K362 F379	P50 T51 T62 H64 S65 G68 I69 P70 F71 N82 V145 H230 K231 T353 H355 K356 F373
BS02	ADP	A	I5 G31 G33 K34 T35 T36 F187 R188 R392	I3 G27 G29 K30 T31 T32 F183 R184 R386
BS03	MG	A	T35 D105 E106	T31 D101 E102
BS04	ALF	A	A30 K34 E106 R188 G365 R390	A26 K30 E102 R184 G359 R384

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Wed Nov 27 22:43:45 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5fhe', asym_id = 'A', title = 'Structural and Functional Insights into the Unwinding Mechanism of Bacteroides sp Pif1'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5fhe', asym_id='A', title='Structural and Functional Insights into the Unwinding Mechanism of Bacteroides sp Pif1')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0000723,0003678,0006281', uniprot = '', pdbid = '5fhe', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0000723,0003678,0006281', uniprot='', pdbid='5fhe', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>