Structure of PDB 5fg8 Chain A

Receptor sequence

>5fg8A (length=269) Species: 7227 (Drosophila melanogaster) [Search protein sequence]

CTRFSDNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQ
KLEREARICRKLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVARE
FYSEADASHCIQQILESVNHCHQNGVVHRDLKPENLLLASKAKGAAVKLA
DFGLAIEVQGDHQAWFGFAGTPGYLSPEVLKKEPYGKSVDIWACGVILYI
LLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDTVTPEAKNLINQMLTVN
PNKRITAAEALKHPWICQR

3D structure

PDB

5fg8 The Interaction between the Drosophila EAG Potassium Channel and the Protein Kinase CaMKII Involves an Extensive Interface at the Active Site of the Kinase.

Chain

Resolution

1.955 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	D136 K138 N141 D157 T177
Catalytic site (residue number reindexed from 1)	D130 K132 N135 D151 T171
Enzyme Commision number	2.7.11.17: calcium/calmodulin-dependent protein kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	A	R53 K57 E97 F99 D136 K138 E140 W171 F172 G173 F174 A175 G176 T177 G179 P212 W215	R47 K51 E91 F93 D130 K132 E134 W165 F166 G167 F168 A169 G170 T171 G173 P206 W209
BS02	ADP	A	G23 S26 V28 A41 K43 V93 E97 L143 D157	G17 S20 V22 A35 K37 V87 E91 L137 D151
BS03	MG	A	N141 D157	N135 D151

Gene Ontology

	Molecular Function
GO:0004672	protein kinase activity
GO:0005524	ATP binding

	Biological Process
GO:0006468	protein phosphorylation

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5fg8, PDBe:5fg8, PDBj:5fg8
PDBsum	5fg8
PubMed	30381148
UniProt	Q00168\|KCC2A_DROME Calcium/calmodulin-dependent protein kinase type II alpha chain (Gene Name=CaMKII)

[Back to BioLiP]