Structure of PDB 5ffd Chain A |
>5ffdA (length=137) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence] |
QWTDQSFIEMMTPHHQDAIDMAEMALQKAEHPELKKLARNIIRDQEREIK EMKTWYQQWFKRPVPAAMDLDALATAQNFDREFIRQMIPHHQMAVMMASN LKTNTERPEMDKLMDDIIRSQSAEIKQMKQWYQNWYG |
|
PDB | 5ffd Structural basis for copper/silver binding by the Synechocystis metallochaperone CopM. |
Chain | A |
Resolution | 1.451 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
AG |
A |
M151 M155 |
M93 M97 |
|
|
|