Structure of PDB 5fd3 Chain A

Receptor sequence

>5fd3A (length=108) Species: 9606 (Homo sapiens) [Search protein sequence]

RKPCNCTKSLCLKLYCDCFANGEFCNNCNCTNCYNNLEHENERQKAIKAC
LDRNPEAFKPKKGCNCKRSGCLKNYCECYEAKIMCSSICKCIGCKNFEES
PERKTLMH

3D structure

PDB

5fd3 Structural basis for LIN54 recognition of CHR elements in cell cycle-regulated promoters.

Chain

Resolution

2.42 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	K534 L535 Y536 R574 C599 N600 C601 K602 R603 S604 Y610 E612	K13 L14 Y15 R53 C64 N65 C66 K67 R68 S69 Y75 E77	PDBbind-CN: Kd=2.8uM
BS02	dna	A	C525 N526 C527 K529 S530 Y536 N609 Y610	C4 N5 C6 K8 S9 Y15 N74 Y75	PDBbind-CN: Kd=2.8uM
BS03	ZN	A	C525 C527 C532 C537	C4 C6 C11 C16
BS04	ZN	A	C532 C546 C551 C554	C11 C25 C30 C33
BS05	ZN	A	C525 C539 C546 C549	C4 C18 C25 C28
BS06	ZN	A	C599 C601 C606 C611	C64 C66 C71 C76
BS07	ZN	A	C606 C620 C626 C629	C71 C85 C91 C94
BS08	ZN	A	C599 C613 C620 C624	C64 C78 C85 C89

External links

PDB	RCSB:5fd3, PDBe:5fd3, PDBj:5fd3
PDBsum	5fd3
PubMed	27465258
UniProt	Q6MZP7\|LIN54_HUMAN Protein lin-54 homolog (Gene Name=LIN54)