Structure of PDB 5fc9 Chain A |
>5fc9A (length=95) Species: 436308 (Nitrosopumilus maritimus SCM1) [Search protein sequence] |
DAQIIIPNGNYDVTGAGFYSPLNLEIPVGTTVTWTNDDSVPHNIQSIDVN GKVIQLFNSPPLNTGDRFEHVFEEEGVYKYYCSFHPWRVGLVTVS |
|
PDB | 5fc9 A Purple Cupredoxin from Nitrosopumilus maritimus Containing a Mononuclear Type 1 Copper Center with an Open Binding Site. |
Chain | A |
Resolution | 1.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
A |
H1043 C1083 H1086 |
H42 C82 H85 |
|
|
|
|