Structure of PDB 5fbi Chain A

Receptor sequence

>5fbiA (length=228) Species: 9606 (Homo sapiens)

ILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQWVLSAAHCLEDAADGK
VQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQLSEKAT
LGPAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLD
RATCNRRTHHDGAITERLMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSG
SRVCGNRKKPGIYTRVASYAAWIDSVLA

3D structure

• PDB: 5fbi Small-molecule factor D inhibitors targeting the alternative complement pathway.
• Chain: A
• Resolution: 1.47 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H57 D102 K192 G193 D194 S195 G196
• Catalytic site (residue number reindexed from 1): H41 D89 K180 G181 D182 S183 G184
• Enzyme Commision number: 3.4.21.46: complement factor D.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	5WD	A	C191 K192 S195 S217 R218	C179 K180 S183 S201 R202	MOAD: Kd=1600uM PDBbind-CN: -logKd/Ki=2.80,Kd=1600uM BindingDB: Kd=1600000nM

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0008236 serine-type peptidase activity

Biological Process

• GO:0006508 proteolysis
• GO:0006956 complement activation
• GO:0006957 complement activation, alternative pathway
• GO:0009617 response to bacterium

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0031093 platelet alpha granule lumen
• GO:0034774 secretory granule lumen
• GO:0070062 extracellular exosome
• GO:1904813 ficolin-1-rich granule lumen

External links

• PDB: RCSB:5fbi, PDBe:5fbi, PDBj:5fbi
• PDBsum: 5fbi
• PubMed: 27775713
• UniProt: P00746|CFAD_HUMAN Complement factor D (Gene Name=CFD)