Structure of PDB 5fae Chain A |
>5faeA (length=108) Species: 9606 (Homo sapiens) [Search protein sequence] |
GSHHVVPNVVQRLFQVKGRRVVRATEVPVSWESFKNGDCFILDLGNNIHQ WCGSNSNRYERLKATQVSKGIRDNERSGRARVHVSEEGTEPEAMLQVLGP KPALPAGT |
|
PDB | 5fae Molecular basis of a novel renal amyloidosis due to N184K gelsolin variant. |
Chain | A |
Resolution | 1.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
A |
G186 D187 E209 |
G37 D38 E60 |
|
|
|
|