Structure of PDB 5f74 Chain A

Receptor sequence
>5f74A (length=229) Species: 10090 (Mus musculus) [Search protein sequence]
TMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYK
NVVGARRSSWRVISSIEQKTNEKKQQMGKEYREKIEAELQDICNDVLELL
DKYLILNATQAESKVFYLKMKGDYFRYLSEVASGENKQTTVSNSQQAYQE
AFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIA
ELDTLNEESYKDSTLIMQLLRDNLTLWTS
3D structure
PDB5f74 Metabolite Regulation of Nuclear Localization of Carbohydrate-response Element-binding Protein (ChREBP): ROLE OF AMP AS AN ALLOSTERIC INHIBITOR.
ChainA
Resolution2.35 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A R58 R62 S66 Y181 E182 T217 L218 Q221 D225 N226 R57 R61 S65 Y178 E179 T214 L215 Q218 D222 N223
BS02 AMP A K51 R58 K122 R129 N175 K50 R57 K119 R126 N172 MOAD: Kd=7.6uM
PDBbind-CN: -logKd/Ki=5.12,Kd=7.6uM
Gene Ontology
Molecular Function
GO:0004860 protein kinase inhibitor activity
GO:0005515 protein binding
GO:0019899 enzyme binding
GO:0019904 protein domain specific binding
GO:0042802 identical protein binding
GO:0042826 histone deacetylase binding
GO:0050815 phosphoserine residue binding
GO:0051219 phosphoprotein binding
Biological Process
GO:0006605 protein targeting
GO:0043085 positive regulation of catalytic activity
GO:0045184 establishment of protein localization
GO:0045744 negative regulation of G protein-coupled receptor signaling pathway
GO:0051220 cytoplasmic sequestering of protein
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0042470 melanosome
GO:0048471 perinuclear region of cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5f74, PDBe:5f74, PDBj:5f74
PDBsum5f74
PubMed26984404
UniProtQ9CQV8|1433B_MOUSE 14-3-3 protein beta/alpha (Gene Name=Ywhab)

[Back to BioLiP]