Structure of PDB 5f6v Chain A

Receptor sequence
>5f6vA (length=156) Species: 9606 (Homo sapiens) [Search protein sequence]
SGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGAAGT
PWAGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDK
DWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQ
AKKFAP
3D structure
PDB5f6v Insights Into the Allosteric Inhibition of the SUMO E2 Enzyme Ubc9.
ChainA
Resolution1.492 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) C93
Catalytic site (residue number reindexed from 1) C92
Enzyme Commision number 2.3.2.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 5VL A E42 C43 K59 L60 R61 E41 C42 K58 L59 R60 MOAD: ic50=5.8mM
PDBbind-CN: -logKd/Ki=2.24,IC50=5.8mM
Gene Ontology
Molecular Function
GO:0001221 transcription coregulator binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008134 transcription factor binding
GO:0016740 transferase activity
GO:0019787 ubiquitin-like protein transferase activity
GO:0019789 SUMO transferase activity
GO:0019899 enzyme binding
GO:0044388 small protein activating enzyme binding
GO:0061656 SUMO conjugating enzyme activity
GO:0071535 RING-like zinc finger domain binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006511 ubiquitin-dependent protein catabolic process
GO:0007059 chromosome segregation
GO:0007084 mitotic nuclear membrane reassembly
GO:0016925 protein sumoylation
GO:0030335 positive regulation of cell migration
GO:0032446 protein modification by small protein conjugation
GO:0036211 protein modification process
GO:0045892 negative regulation of DNA-templated transcription
GO:0051168 nuclear export
GO:0051301 cell division
GO:1903755 positive regulation of SUMO transferase activity
Cellular Component
GO:0000795 synaptonemal complex
GO:0005634 nucleus
GO:0005635 nuclear envelope
GO:0005643 nuclear pore
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0016605 PML body
GO:0048471 perinuclear region of cytoplasm
GO:0106068 SUMO ligase complex
GO:1990234 transferase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5f6v, PDBe:5f6v, PDBj:5f6v
PDBsum5f6v
PubMed27038327
UniProtP63279|UBC9_HUMAN SUMO-conjugating enzyme UBC9 (Gene Name=UBE2I)

[Back to BioLiP]