Structure of PDB 5eys Chain A

Receptor sequence
>5eysA (length=148) Species: 10090 (Mus musculus) [Search protein sequence]
RPESELIRQSWRVVSRSPLEHGTVLFARLFALEPSLLPLFQYNGRQFSSP
EDSLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLTSLGRKHRAVGVR
LSSWSTVGESLLYMLEKSLGPDFTPATRTAWSRLYGAVVQAMSRGWDG
3D structure
PDB5eys Determinants of neuroglobin plasticity highlighted by joint coarse-grained simulations and high pressure crystallography.
ChainA
Resolution1.75 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.7.-.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM A F42 Y44 H64 K67 V68 V71 L92 K95 H96 V99 V101 W106 V109 F40 Y42 H62 K65 V66 V69 L90 K93 H94 V97 V99 W104 V107
Gene Ontology
Molecular Function
GO:0005092 GDP-dissociation inhibitor activity
GO:0005344 oxygen carrier activity
GO:0005515 protein binding
GO:0016491 oxidoreductase activity
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0046872 metal ion binding
GO:0098809 nitrite reductase activity
Biological Process
GO:0015671 oxygen transport
GO:0071456 cellular response to hypoxia
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005759 mitochondrial matrix
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5eys, PDBe:5eys, PDBj:5eys
PDBsum5eys
PubMed28500341
UniProtQ9ER97|NGB_MOUSE Neuroglobin (Gene Name=Ngb)

[Back to BioLiP]