Structure of PDB 5ewh Chain A |
>5ewhA (length=113) Species: 9606 (Homo sapiens) [Search protein sequence] |
EMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFF TMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGG AVLRQARRQAEKM |
|
PDB | 5ewh Twenty Crystal Structures of Bromodomain and PHD Finger Containing Protein 1 (BRPF1)/Ligand Complexes Reveal Conserved Binding Motifs and Rare Interactions. |
Chain | A |
Resolution | 1.63 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
5SG |
A |
I652 N708 F714 |
I26 N82 F88 |
MOAD: Kd=170uM PDBbind-CN: -logKd/Ki=3.77,Kd=170uM BindingDB: Kd=170000nM |
|
|