Structure of PDB 5ewf Chain A

Receptor sequence

>5ewfA (length=425) Species: 9606 (Homo sapiens)

GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGI
IAVSYEARAFGVTRSMWADDAKKLCPDLLLAQVRESRGKANLTKYREASV
EVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYI
EGLPQGVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAI
ERETGFQCSAGISHNKVLAKLACGLNKPNRQTLVSHGSVPQLFSQMPIRK
IRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRG
IEHDPVKPRQLPKTIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTK
DRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAFTVIK
NCNTSTEWSPPLTMLFLCATKFSAS

3D structure

• PDB: 5ewf Mechanism of Ribonucleotide Incorporation by Human DNA Polymerase eta.
• Chain: A
• Resolution: 1.782 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	Q38 Y39 W42 R61 S62 K86 K311 R313 P316 K317 T318 I319 G320 C321 S322 K323 N324 P326 G327 R351	Q41 Y42 W45 R64 S65 K89 K307 R309 P312 K313 T314 I315 G316 C317 S318 K319 N320 P322 G323 R347
BS02	dna	A	S113 E116 K224 S257 G259 G260 K261 L262 R377 L381 R382 R383	S116 E119 K220 S253 G255 G256 K257 L258 R373 L377 R378 R379
BS03	CA	A	D13 M14 D115	D16 M17 D118
BS04	CTP	A	M14 D15 C16 F18 I48 Y52 R55 R61 D115	M17 D18 C19 F21 I51 Y55 R58 R64 D118

Gene Ontology

Molecular Function

• GO:0003684 damaged DNA binding

Biological Process

• GO:0006281 DNA repair

External links

• PDB: RCSB:5ewf, PDBe:5ewf, PDBj:5ewf
• PDBsum: 5ewf
• PubMed: 26740629
• UniProt: Q9Y253|POLH_HUMAN DNA polymerase eta (Gene Name=POLH)