Structure of PDB 5ewd Chain A |
>5ewdA (length=113) Species: 9606 (Homo sapiens) [Search protein sequence] |
EMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFF TMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGG AVLRQARRQAEKM |
|
PDB | 5ewd Twenty Crystal Structures of Bromodomain and PHD Finger Containing Protein 1 (BRPF1)/Ligand Complexes Reveal Conserved Binding Motifs and Rare Interactions. |
Chain | A |
Resolution | 1.58 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
5SH |
A |
V662 N708 F714 |
V36 N82 F88 |
PDBbind-CN: -logKd/Ki=3.70,Kd>200uM BindingDB: Kd=>200000nM |
|
|