Structure of PDB 5ev4 Chain A

Receptor sequence

>5ev4A (length=197) Species: 9606 (Homo sapiens) [Search protein sequence]

MTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQ
DKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPS
VYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKD
SATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAK

3D structure

PDB

5ev4 An extended U2AF(65)-RNA-binding domain recognizes the 3' splice site signal.

Chain

Resolution

1.57 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	R146 Q147 R150 Y152 F197 F199 K225 R227 R228 P229 H230 D231 T252 V254 K260 F262 G264 G265 N268 N289 D293 S294 L298 K300 Y302 F304 K328 K329 A335 G338 A339 K340	R3 Q4 R7 Y9 F54 F56 K82 R84 R85 P86 H87 D88 T109 V111 K117 F119 G121 G122 N125 N146 D150 S151 L155 K157 Y159 F161 K185 K186 A192 G195 A196 K197

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding

	Biological Process
GO:0006397	mRNA processing

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5ev4, PDBe:5ev4, PDBj:5ev4
PDBsum	5ev4
PubMed	26952537
UniProt	P26368\|U2AF2_HUMAN Splicing factor U2AF 65 kDa subunit (Gene Name=U2AF2)

[Back to BioLiP]