Structure of PDB 5etb Chain A |
>5etbA (length=112) Species: 9606 (Homo sapiens) [Search protein sequence] |
MQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFT MKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGA VLRQARRQAEKM |
|
PDB | 5etb Twenty Crystal Structures of Bromodomain and PHD Finger Containing Protein 1 (BRPF1)/Ligand Complexes Reveal Conserved Binding Motifs and Rare Interactions. |
Chain | A |
Resolution | 1.33 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
5RO |
A |
F653 V657 F714 |
F26 V30 F87 |
MOAD: Kd=29uM PDBbind-CN: -logKd/Ki=4.54,Kd=29uM BindingDB: Kd=29000nM |
|
|