Structure of PDB 5er9 Chain A

Receptor sequence

>5er9A (length=394) Species: 246196 (Mycolicibacterium smegmatis MC2 155)

STGNFDLFVVGSGFFGLTIAERAATQLGKRVLVIERRPHIGGNAYSEPEP
ETGIEVHKYGAHLFHTSNKRVWDYVRQFTDFTGYQHRVFAMHNGQAYQFP
MGLGLVSQFFGRYFSPDEARALIAEQASEIDTKDAKNFEEKAISLVGRPL
YEAFIKHYTAKQWQTDPKDLPASNITRLPVRYTFDNRYFNDTYEGLPVEG
YTKWLENMAADERIEVRLDTDWFDVRDDLRAANPDAPVVYTGPLDRYFDY
AEGRLGWRTLDFELEVLETGDFQGTPVMNYNDLDVPYTRIHEFRHFHPER
TYPTDKTVIMREYSRFADNDDEPYYPINTEADRAVLAAYRARAKAETASA
KVLFGGRLGTYQYLDMHMAIASALSMFDNVLAPHLSEGASLVTE

3D structure

• PDB: 5er9 Structural dynamics of UDP-galactopyranose mutase from Mycobacterium smegmatis
• Chain: A
• Resolution: 1.689 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R189 R193 R270 R301 E324 Y375 D377
• Catalytic site (residue number reindexed from 1): R177 R181 R258 R289 E312 Y363 D365
• Enzyme Commision number: 5.4.99.9: UDP-galactopyranose mutase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	UDP	A	F111 I167 Y170 T171 Q174 Y200 N291 R301 Y337	F99 I155 Y158 T159 Q162 Y188 N279 R289 Y325
BS02	FAD	A	V22 G23 G25 F26 F27 I46 E47 R48 G54 N55 A73 H74 L75 W234 F235 G254 Y336 G368 R369 Y375 L376 D377 M378 A381	V10 G11 G13 F14 F15 I34 E35 R36 G42 N43 A61 H62 L63 W222 F223 G242 Y324 G356 R357 Y363 L364 D365 M366 A369

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0008767 UDP-galactopyranose mutase activity
• GO:0016853 isomerase activity
• GO:0046872 metal ion binding
• GO:0050660 flavin adenine dinucleotide binding

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:5er9, PDBe:5er9, PDBj:5er9
• PDBsum: 5er9
• UniProt: A0R629