Structure of PDB 5eqh Chain A

Receptor sequence
>5eqhA (length=447) Species: 9606 (Homo sapiens) [Search protein sequence]
TGRLMLAVGGAVLGSLQFGYNTGVINAPQKVIEEFYNQTWVHRYGESILP
TTLTTLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSAV
LMGFSKLGKSFEMLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALGT
LHQLGIVVGILIAQVFGLDSIMGNKDLWPLLLSIIFIPALLQCIVLPFCP
ESPRFLLINRNEENRAKSVLKKLRGTADVTHDLQEMKEESRQMMREKKVT
ILELFRSPAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFEKAGVQQPVY
ATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAILMTIALALL
EQLPWMSYLSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAG
FSNWTSNFIVGMCFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPET
3D structure
PDB5eqh Mechanism of inhibition of human glucose transporter GLUT1 is conserved between cytochalasin B and phenylalanine amides.
ChainA
Resolution2.99 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 5RF A S80 T137 Q282 F379 W388 G408 N411 W412 S72 T129 Q274 F371 W380 G400 N403 W404
Gene Ontology
Molecular Function
GO:0005324 long-chain fatty acid transmembrane transporter activity
GO:0005515 protein binding
GO:0019900 kinase binding
GO:0022857 transmembrane transporter activity
GO:0033300 dehydroascorbic acid transmembrane transporter activity
GO:0042802 identical protein binding
GO:0042910 xenobiotic transmembrane transporter activity
GO:0055056 D-glucose transmembrane transporter activity
Biological Process
GO:0001666 response to hypoxia
GO:0007417 central nervous system development
GO:0007565 female pregnancy
GO:0015911 long-chain fatty acid import across plasma membrane
GO:0019852 L-ascorbic acid metabolic process
GO:0021987 cerebral cortex development
GO:0032868 response to insulin
GO:0042149 cellular response to glucose starvation
GO:0042908 xenobiotic transport
GO:0045494 photoreceptor cell maintenance
GO:0046323 D-glucose import
GO:0055085 transmembrane transport
GO:0065003 protein-containing complex assembly
GO:0070837 dehydroascorbic acid transport
GO:0071260 cellular response to mechanical stimulus
GO:0071474 cellular hyperosmotic response
GO:0098708 D-glucose import across plasma membrane
GO:0150104 transport across blood-brain barrier
GO:1904016 response to Thyroglobulin triiodothyronine
GO:1904659 D-glucose transmembrane transport
Cellular Component
GO:0000139 Golgi membrane
GO:0001674 female germ cell nucleus
GO:0001917 photoreceptor inner segment
GO:0001939 female pronucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0005901 caveola
GO:0005911 cell-cell junction
GO:0014704 intercalated disc
GO:0016020 membrane
GO:0016323 basolateral plasma membrane
GO:0016324 apical plasma membrane
GO:0030018 Z disc
GO:0030496 midbody
GO:0030864 cortical actin cytoskeleton
GO:0031982 vesicle
GO:0042383 sarcolemma
GO:0042470 melanosome
GO:0045121 membrane raft
GO:0045202 synapse
GO:0070062 extracellular exosome
GO:0072562 blood microparticle
GO:0098793 presynapse
GO:1990350 glucose transporter complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5eqh, PDBe:5eqh, PDBj:5eqh
PDBsum5eqh
PubMed27078104
UniProtP11166|GTR1_HUMAN Solute carrier family 2, facilitated glucose transporter member 1 (Gene Name=SLC2A1)

[Back to BioLiP]