Structure of PDB 5eqf Chain A

Receptor sequence

>5eqfA (length=386) Species: 257309 (Corynebacterium diphtheriae NCTC 13129)

SDFDLIVVGSGLFGLTVAERAASQLGKKVLIVEKRSHLGGNAYSEAEPET
GIEIHKYGAHLFHTSNKRVWDYVNQFTAFTGYQHRVFAMHNGTAYQFPMG
LGLINQFFGRYYTPDEARELIKEQSAEIDSKDATNLEEKAISLIGRPLYE
AFIRDYTAKQWQTDPKELPAGNITRLPVRYNFDNRYFNDTYEGLPVDGYA
QWLSNMADHENIEVRLDTDWFEVREDLRAQNPEAPVVYTGPLDRYFDYSE
GHLGWRTLDFETEVLNTGDFQGTPVMNYNDAEFPYTRIHEFRHFHPERED
RHPKDKTVIMKEYSRFAEEGDEPYYPINTPSDREMLFKYRELADAETESG
KVYFGGRLGTYQYLDMHMAIASALSMFDNKLVDALK

3D structure

• PDB: 5eqf Conformational Control of UDP-Galactopyranose Mutase Inhibition.
• Chain: A
• Resolution: 2.145 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R176 R180 R257 R288 E313 Y364 D366
• Catalytic site (residue number reindexed from 1): R175 R179 R256 R287 E312 Y363 D365
• Enzyme Commision number: 5.4.99.9: UDP-galactopyranose mutase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	UDP	A	F98 I154 Y157 T158 W162 N173 R176 L177 Y187 N278 R288 Y326 Y364	F97 I153 Y156 T157 W161 N172 R175 L176 Y186 N277 R287 Y325 Y363
BS02	FAD	A	V9 G10 G12 F14 V33 E34 K35 R36 A60 H61 L62 D220 W221 F222 G357 R358 L365 D366 M367	V8 G9 G11 F13 V32 E33 K34 R35 A59 H60 L61 D219 W220 F221 G356 R357 L364 D365 M366

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0008767 UDP-galactopyranose mutase activity
• GO:0016853 isomerase activity
• GO:0050660 flavin adenine dinucleotide binding

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:5eqf, PDBe:5eqf, PDBj:5eqf
• PDBsum: 5eqf
• PubMed: 28608671
• UniProt: Q6NER4