Structure of PDB 5epr Chain A |
>5eprA (length=112) Species: 9606 (Homo sapiens) [Search protein sequence] |
MQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFT MKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGA VLRQARRQAEKM |
|
PDB | 5epr Twenty Crystal Structures of Bromodomain and PHD Finger Containing Protein 1 (BRPF1)/Ligand Complexes Reveal Conserved Binding Motifs and Rare Interactions. |
Chain | A |
Resolution | 1.65 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
5QY |
A |
V657 V662 F714 |
V30 V35 F87 |
MOAD: Kd=91uM PDBbind-CN: -logKd/Ki=4.04,Kd=91uM BindingDB: Kd=91000nM |
|
|