Structure of PDB 5enc Chain A |
>5encA (length=124) Species: 9606 (Homo sapiens) [Search protein sequence] |
SMSYDIQAWKKQCEELLNLIFQCEDSEPFRQPVDLLEYPDYRDIIDTPMD FATVRETLEAGNYESPMELCKDVRLIFSNSKAYTPSKRSRIYSMSLRLSA FFEEHISSVLSDYKSALRFHKRNT |
|
PDB | 5enc A poised fragment library enables rapid synthetic expansion yielding the first reported inhibitors of PHIP(2), an atypical bromodomain. |
Chain | A |
Resolution | 1.59 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
5QD |
A |
V1345 Y1350 |
V33 Y38 |
PDBbind-CN: -logKd/Ki=2.30,IC50>5mM |
|
|