Structure of PDB 5emu Chain A

Receptor sequence

>5emuA (length=248) Species: 83333 (Escherichia coli K-12)

DLKASSLRALKLMDLTTLNDDDTDEKVIALCHQAKTPVGNTAAICIYPRF
IPIARETLKEQGTPEIRIATVTNFPHGNDDIDIALAETRAAIAWGADEVD
VVFPYRALMAGNEQVGFDLVKACKEACAAANVLLKVIIETGELKDEALIR
KASEISIKAGADFIKTSTGKVAVNATPESARIMMEVIRDMGVEKTVGFKP
AGGVRTAEDAQKYLAIADELFGADWADARHYRFGASSLLASLLKALGH

3D structure

• PDB: 5emu Mechanism-based inhibition of an aldolase at high concentrations of its natural substrate acetaldehyde: structural insights and protective strategies.
• Chain: A
• Resolution: 1.5 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D102 K167 K201
• Catalytic site (residue number reindexed from 1): D100 K165 K199
• Enzyme Commision number: 4.1.2.4: deoxyribose-phosphate aldolase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	1BO	A	C47 K167 K201 H250	C45 K165 K199 H248

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0004139 deoxyribose-phosphate aldolase activity
• GO:0016829 lyase activity

Biological Process

• GO:0006018 2-deoxyribose 1-phosphate catabolic process
• GO:0006974 DNA damage response
• GO:0009264 deoxyribonucleotide catabolic process
• GO:0015949 nucleobase-containing small molecule interconversion
• GO:0016052 carbohydrate catabolic process
• GO:0046386 deoxyribose phosphate catabolic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0016020 membrane

External links

• PDB: RCSB:5emu, PDBe:5emu, PDBj:5emu
• PDBsum: 5emu
• PubMed: 30155096
• UniProt: P0A6L0|DEOC_ECOLI Deoxyribose-phosphate aldolase (Gene Name=deoC)