Structure of PDB 5emc Chain A

Receptor sequence
>5emcA (length=70) Species: 9606 (Homo sapiens) [Search protein sequence]
KLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKI
RRKNCPACRYRKCLQAGMNL
3D structure
PDB5emc The effects of cytosine methylation on general transcription factors
ChainA
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A C450 H451 Y452 K461 C13 H14 Y15 K24
BS02 dna A S459 V462 R466 R489 R496 S22 V25 R29 R52 R59
BS03 ZN A C440 C443 C457 C460 C3 C6 C20 C23
BS04 ZN A C476 C482 C492 C495 C39 C45 C55 C58
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5emc, PDBe:5emc, PDBj:5emc
PDBsum5emc
PubMed
UniProtP04150|GCR_HUMAN Glucocorticoid receptor (Gene Name=NR3C1)

[Back to BioLiP]