Structure of PDB 5eko Chain A

Receptor sequence
>5ekoA (length=341) Species: 9606 (Homo sapiens) [Search protein sequence]
SLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKV
AIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFY
DFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKYIHSAGVVHRDL
KPGNLAVNEDCELKILDFGLGYVVTRWYRAPEVILSWMHYNQTVDIWSVG
CIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQ
SLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEP
FRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSP
3D structure
PDB5eko First comprehensive structural and biophysical analysis of MAPK13 inhibitors targeting DFG-in and DFG-out binding modes.
ChainA
Resolution2.0 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) D150 K152 N155 D168 T185
Catalytic site (residue number reindexed from 1) D149 K151 N154 D167 T175
Enzyme Commision number 2.7.11.24: mitogen-activated protein kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 N17 A A52 R68 E72 M107 M110 L167 D168 F169 L171 A51 R67 E71 M106 M109 L166 D167 F168 L170 MOAD: ic50=15785nM
PDBbind-CN: -logKd/Ki=4.80,IC50=15785nM
BindingDB: IC50=15785nM
Gene Ontology
Molecular Function
GO:0004672 protein kinase activity
GO:0004674 protein serine/threonine kinase activity
GO:0004707 MAP kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0106310 protein serine kinase activity
Biological Process
GO:0000165 MAPK cascade
GO:0006468 protein phosphorylation
GO:0006970 response to osmotic stress
GO:0016310 phosphorylation
GO:0018105 peptidyl-serine phosphorylation
GO:0032755 positive regulation of interleukin-6 production
GO:0033554 cellular response to stress
GO:0034644 cellular response to UV
GO:0035556 intracellular signal transduction
GO:0050729 positive regulation of inflammatory response
GO:0051403 stress-activated MAPK cascade
GO:0070301 cellular response to hydrogen peroxide
GO:0071347 cellular response to interleukin-1
GO:0072709 cellular response to sorbitol
GO:0072740 cellular response to anisomycin
GO:1903936 cellular response to sodium arsenite
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5eko, PDBe:5eko, PDBj:5eko
PDBsum5eko
PubMed27369736
UniProtO15264|MK13_HUMAN Mitogen-activated protein kinase 13 (Gene Name=MAPK13)

[Back to BioLiP]