Structure of PDB 5ejw Chain A |
>5ejwA (length=80) Species: 10090 (Mus musculus) [Search protein sequence] |
HHSSGLVPRGSHMELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPK YSTWEPEEHILDPRLVMAYEEKEERDRASG |
|
PDB | 5ejw Structure-Guided Discovery of Selective Antagonists for the Chromodomain of Polycomb Repressive Protein CBX7. |
Chain | A |
Resolution | 2.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
5PZ |
A |
F11 W32 W35 |
F23 W44 W47 |
PDBbind-CN: -logKd/Ki=3.30,Kd=500uM |
|
|
|