Structure of PDB 5eer Chain A

Receptor sequence

>5eerA (length=247) Species: 196627 (Corynebacterium glutamicum ATCC 13032)

GIKVGVLGAKGRVGQTIVAAVNESDDLELVAEIGVDDDLSLLVDNGAEVV
VDFTTPNAVMGNLEFCINNGISAVVGTTGFDDARLEQVRDWLEGKDNVGV
LIAPNFAISAVLTMVFSKQAARFFESAEVIELHHPNKLDAPSGTAIHTAQ
GIAAARKEAGMDAQPDATEQALEGSRGASVDGIPVHAVRMSGMVAHEQVI
FGTQGQTLTIKQDSYDRNSFAPGVLVGVRNIAQHPGLVVGLEHYLGL

3D structure

• PDB: 5eer Structural Insight into Dihydrodipicolinate Reductase from Corybebacterium glutamicum for Lysine Biosynthesis.
• Chain: A
• Resolution: 2.5 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H134 K138
• Catalytic site (residue number reindexed from 1): H133 K137
• Enzyme Commision number: 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SO4	A	K138 S143 G144 T145	K137 S142 G143 T144
BS02	SO4	A	H135 K138	H134 K137

Gene Ontology

Molecular Function

• GO:0008839 4-hydroxy-tetrahydrodipicolinate reductase
• GO:0016491 oxidoreductase activity
• GO:0016726 oxidoreductase activity, acting on CH or CH2 groups, NAD or NADP as acceptor
• GO:0050661 NADP binding
• GO:0051287 NAD binding

Biological Process

• GO:0009085 lysine biosynthetic process
• GO:0009089 lysine biosynthetic process via diaminopimelate
• GO:0019877 diaminopimelate biosynthetic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:5eer, PDBe:5eer, PDBj:5eer
• PDBsum: 5eer
• PubMed: 26502738
• UniProt: P40110|DAPB_CORGL 4-hydroxy-tetrahydrodipicolinate reductase (Gene Name=dapB)