Structure of PDB 5eea Chain A

Receptor sequence
>5eeaA (length=62) Species: 9606 (Homo sapiens) [Search protein sequence]
RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQN
RRVKEKKVLAKV
3D structure
PDB5eea Two distinct DNA sequences recognized by transcription factors represent enthalpy and entropy optima.
ChainA
Resolution2.195 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A K225 G226 K9 G10 PDBbind-CN: Kd=41nM
BS02 dna A R217 K218 R220 I221 Y223 I262 N266 K270 R1 K2 R4 I5 Y7 I46 N50 K54 PDBbind-CN: Kd=41nM
BS03 dna A R220 K243 R246 Q265 R268 K272 R4 K27 R30 Q49 R52 K56 PDBbind-CN: Kd=41nM
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5eea, PDBe:5eea, PDBj:5eea
PDBsum5eea
PubMed29638214
UniProtQ92826|HXB13_HUMAN Homeobox protein Hox-B13 (Gene Name=HOXB13)

[Back to BioLiP]