Structure of PDB 5edv Chain A

Receptor sequence

>5edvA (length=286) Species: 9606 (Homo sapiens)

CAVCGWALPMQALTSCECTICPDCFRQHFTIALKEKHITDMVCPACGRPD
LTDDTQLLSYFSTLDIQLRESLEPDAYALFHKKLTEGVLMRDPKFLWCAQ
CSFGFIYEREQLEATCPQCHQTFCVRCKRQWEEQHRGRSCEDFQNWKRMN
DPEYQAQGLAMYLQENGIDCPKCKFSYALARGGCMHFHCTQCRHQFCSGC
YNAFYAKNKCPEPNCRVKKSLHGHHPRDCLFYLRDWTALRLQKLLQDCRV
IEQKEVPNGLRDEACGKETPGLCQAHYKEYLVSLIN

3D structure

• PDB: 5edv Structure of a HOIP/E2~ubiquitin complex reveals RBR E3 ligase mechanism and regulation.
• Chain: A
• Resolution: 3.48 Å

Enzymatic activity

• Enzyme Commision number: 2.3.2.31: RBR-type E3 ubiquitin transferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	C699 C702 C722 C725	C1 C4 C21 C24
BS02	ZN	A	C717 C719 C744 C747	C16 C18 C43 C46
BS03	ZN	A	C799 C802 C817 C820	C98 C101 C116 C119
BS04	ZN	A	C825 C828 H836 C841	C124 C127 H135 C140
BS05	ZN	A	C871 C874 C890 C893	C170 C173 C189 C192
BS06	ZN	A	C898 C901 H926 C930	C197 C200 H225 C229
BS07	ZN	A	C911 C916 H923 H925	C210 C215 H222 H224
BS08	ZN	A	C969 C986 C998 H1001	C248 C265 C273 H276

Gene Ontology

Molecular Function

• GO:0004842 ubiquitin-protein transferase activity
• GO:0008270 zinc ion binding

Cellular Component

• GO:0071797 LUBAC complex

External links

• PDB: RCSB:5edv, PDBe:5edv, PDBj:5edv
• PDBsum: 5edv
• PubMed: 26789245
• UniProt: Q96EP0|RNF31_HUMAN E3 ubiquitin-protein ligase RNF31 (Gene Name=RNF31)