Structure of PDB 5ed2 Chain A

Receptor sequence

>5ed2A (length=385) Species: 9606 (Homo sapiens)

QLHLPQVLADAVSRLVLGKFGDLTDNFSSPHARRKVLAGVVMTTGTDVKD
AKVISVSTGTKCINGEYMSDRGLALNDCHAEIISRRSLLRFLYTQLELYL
NNKDDQKRSIFQKSERGGFRLKENVQFHLYISTSPCGDARIFSPHEPILE
EPADRHPNRKARGQLRTKIESGQGTIPVRSNASIQTWDGVLQGERLLTMS
CSDKIARWNVVGIQGSLLSIFVEPIYFSSIILGSLYHGDHLSRAMYQRIS
NIEDLPPLYTLNKPLLSGISNAEARQPGKAPNFSVNWTVGDSAIEVINAT
TGKDELGRASRLCKHALYCRWMRVHGKVPSHLLRSKITKPNVYHESKLAA
KEYQAAKARLFTAFIKAGLGAWVEKPTEQDQFSLT

3D structure

• PDB: 5ed2 Structures of human ADAR2 bound to dsRNA reveal base-flipping mechanism and basis for site selectivity.
• Chain: A
• Resolution: 2.95 Å

Enzymatic activity

• Enzyme Commision number: 3.5.4.37: double-stranded RNA adenine deaminase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	V351 T375 K376 H394 E396 P450 C451 R455 H471 R474 K475 S486 G487 Q488 G489 C516	V36 T60 K61 H79 E81 P135 C136 R140 H156 R159 K160 S171 G172 Q173 G174 C201
BS02	rna	A	R348 I456 F457 R470 R474 R477 R481 G487 Q488 I491 P492 R494 R510 G593 K594	R33 I141 F142 R155 R159 R162 R166 G172 Q173 I176 P177 R179 R195 G278 K279
BS03	IHP	A	I397 R401 K519 R522 S531 K629 Y658 K662 Y668 K672 E689 K690	I82 R86 K204 R207 S216 K314 Y343 K347 Y353 K357 E374 K375
BS04	ZN	A	H394 C451 C516	H79 C136 C201

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0004000 adenosine deaminase activity

Biological Process

• GO:0006396 RNA processing

External links

• PDB: RCSB:5ed2, PDBe:5ed2, PDBj:5ed2
• PDBsum: 5ed2
• PubMed: 27065196
• UniProt: P78563|RED1_HUMAN Double-stranded RNA-specific editase 1 (Gene Name=ADARB1)