Structure of PDB 5e9v Chain A |
>5e9vA (length=113) Species: 9606 (Homo sapiens) [Search protein sequence] |
STPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMK DKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMM SKERLLALKRSMS |
|
PDB | 5e9v Crystal structure of BRD9 bromodomain in complex with an indolizine ligand |
Chain | A |
Resolution | 1.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
5L0 |
A |
F160 I169 N216 Y222 |
F23 I32 N79 Y85 |
|
|
|