Structure of PDB 5e8i Chain A

Receptor sequence
>5e8iA (length=93) Species: 9606 (Homo sapiens) [Search protein sequence]
GQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKP
NMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQP
3D structure
PDB5e8i Structural Basis for Dimerization and DNA Binding of Transcription Factor FLI1.
ChainA
Resolution3.45 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A Y332 R337 R340 Y341 Y343 K350 R355 Y356 Y54 R59 R62 Y63 Y65 K72 R77 Y78 PDBbind-CN: Kd=16nM
BS02 dna A Q282 L283 W321 K325 K327 M330 K334 Y341 Y342 Q4 L5 W43 K47 K49 M52 K56 Y63 Y64 PDBbind-CN: Kd=16nM
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5e8i, PDBe:5e8i, PDBj:5e8i
PDBsum5e8i
PubMed26618620
UniProtQ01543|FLI1_HUMAN Friend leukemia integration 1 transcription factor (Gene Name=FLI1)

[Back to BioLiP]