Structure of PDB 5e8g Chain A |
>5e8gA (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] |
GQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKP NMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQP |
|
PDB | 5e8g Structural Basis for Dimerization and DNA Binding of Transcription Factor FLI1. |
Chain | A |
Resolution | 2.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CO |
A |
D361 H363 |
D83 H85 |
|
|
|
|