Structure of PDB 5e3d Chain A |
>5e3dA (length=112) Species: 9606 (Homo sapiens) [Search protein sequence] |
MQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFT MKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGA VLRQARRQAEKM |
|
PDB | 5e3d Twenty Crystal Structures of Bromodomain and PHD Finger Containing Protein 1 (BRPF1)/Ligand Complexes Reveal Conserved Binding Motifs and Rare Interactions. |
Chain | A |
Resolution | 1.71 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
5JL |
A |
V657 N708 F714 |
V30 N81 F87 |
MOAD: Kd=95uM PDBbind-CN: -logKd/Ki=4.02,Kd=95uM |
|
|