Structure of PDB 5e37 Chain A

Receptor sequence

>5e37A (length=313) Species: 3055 (Chlamydomonas reinhardtii)

GLMDDASKAKMEELERRFKMADVDGNGHIDREELRNLLESMESGEVYMMS
QHWLPEDELERCMEQYDVNKDGVISFEEFKQIIYDGLLLEGTLAEYESAF
KAVDKSGNGTIGATELSKLFASLGNPVSLEKLVDLMQMYDKDDSGQIEFP
EFLLMFRNSLLDLKDMTTYMTLGSSGSLVDAVEGDMTLIFSEEELDALIS
ANPDKLVVVFGALTWCRPCKGMQRPVQKLAEHYKDHIVFVKLFGNANKQT
KRIFKERFQIRSTPCFITLRKGEPVYTQTGSNKEKLEAGLRSLIANPPVG
MIYPSAEALAALQ

3D structure

• PDB: 5e37 Calredoxin represents a novel type of calcium-dependent sensor-responder connected to redox regulation in the chloroplast
• Chain: A
• Resolution: 1.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	A	D39 D41 N43 H45 E50	D22 D24 N26 H28 E33
BS02	CA	A	D84 N86 D88 V90 E95	D67 N69 D71 V73 E78
BS03	CA	A	D121 S123 N125 T127 E132	D104 S106 N108 T110 E115
BS04	CA	A	D157 D159 S161 Q163 E165 E168	D140 D142 S144 Q146 E148 E151

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Thu Dec 5 11:22:38 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5e37', asym_id = 'A', title = 'Calredoxin represents a novel type of calcium-de... connected to redox regulation in the chloroplast'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5e37', asym_id='A', title='Calredoxin represents a novel type of calcium-de... connected to redox regulation in the chloroplast')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0005509', uniprot = '', pdbid = '5e37', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0005509', uniprot='', pdbid='5e37', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>