Structure of PDB 5e1n Chain A

Receptor sequence
>5e1nA (length=145) Species: 5888 (Paramecium tetraurelia) [Search protein sequence]
QLTEEQIAEFKEAFALFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMI
NEVDADGNGTIDFPEFLSLMARKMKEQDSEEELIEAFKVFDRDGNGLISA
AELRHVMTNLGEKLTDDEVDEMIREADIDGDGHINYEEFVRMMVS
3D structure
PDB5e1n Atomic resolution experimental phase information reveals extensive disorder and bound 2-methyl-2,4-pentanediol in Ca(2+)-calmodulin.
ChainA
Resolution1.0 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) V35
Catalytic site (residue number reindexed from 1) V33
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA A D20 D22 D24 T26 E31 D18 D20 D22 T24 E29
BS02 CA A D56 D58 N60 T62 E67 D54 D56 N58 T60 E65
BS03 CA A D129 D131 D133 H135 E140 D127 D129 D131 H133 E138
BS04 CA A D93 D95 N97 L99 E104 D91 D93 N95 L97 E102
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0030234 enzyme regulator activity
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:5e1n, PDBe:5e1n, PDBj:5e1n
PDBsum5e1n
PubMed26894537
UniProtP07463|CALM_PARTE Calmodulin (Gene Name=CAM)

[Back to BioLiP]