Structure of PDB 5dyc Chain A |
>5dycA (length=113) Species: 9606 (Homo sapiens) [Search protein sequence] |
EMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFF TMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGG AVLRQARRQAEKM |
|
PDB | 5dyc Twenty Crystal Structures of Bromodomain and PHD Finger Containing Protein 1 (BRPF1)/Ligand Complexes Reveal Conserved Binding Motifs and Rare Interactions. |
Chain | A |
Resolution | 1.65 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
5GU |
A |
V657 P658 E661 F714 |
V31 P32 E35 F88 |
|
|
|