Structure of PDB 5dtw Chain A

Receptor sequence
>5dtwA (length=244) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence]
HMIGITQAEAVLTIELQRPERRNALNSQLVEELTQAIRKAGDGSARAIVL
TGQGTAFCAGADLSGDAFAADYPDRLIELHKAMDASPMPVVGAINGPAIG
AGLQLAMQCDLRVVAPDAFFQFPTSKYGLALDNWSIRRLSSLVGHGRARA
MLLSAEKLTAEIALHTGMANRIGTLADAQAWAAEIARLAPLAIQHAKRVL
NDDGAIEEAWPAHKELFDKAWGSQDVIEAQVARMEKRPPKFQGA
3D structure
PDB5dtw THPP target assignment reveals EchA6 as an essential fatty acid shuttle in mycobacteria.
ChainA
Resolution2.439 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) A60 D65 P72 I76 A100 Q103 P122 T123 L128 L130 D131 P210 W220
Catalytic site (residue number reindexed from 1) A61 D66 P73 I77 A101 Q104 P123 T124 L129 L131 D132 P211 W221
Enzyme Commision number 4.2.1.17: enoyl-CoA hydratase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 5F9 A E19 R20 R21 A23 A58 A60 D61 L62 H79 D83 G99 A100 Y126 W133 E20 R21 R22 A24 A59 A61 D62 L63 H80 D84 G100 A101 Y127 W134 MOAD: Kd=3.5uM
PDBbind-CN: -logKd/Ki=5.46,Kd=3.5uM
BS02 5F9 A R17 R20 R18 R21 MOAD: Kd=3.5uM
PDBbind-CN: -logKd/Ki=5.46,Kd=3.5uM
Gene Ontology
Molecular Function
GO:0003824 catalytic activity
GO:0004300 enoyl-CoA hydratase activity
GO:0016829 lyase activity
GO:0016836 hydro-lyase activity
Biological Process
GO:0006631 fatty acid metabolic process
GO:0006635 fatty acid beta-oxidation
Cellular Component
GO:0005886 plasma membrane
GO:0009274 peptidoglycan-based cell wall

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5dtw, PDBe:5dtw, PDBj:5dtw
PDBsum5dtw
PubMed27571973
UniProtP9WNP1|ECHA6_MYCTU Probable enoyl-CoA hydratase EchA6 (Gene Name=echA6)

[Back to BioLiP]