Structure of PDB 5dpm Chain A

Receptor sequence

>5dpmA (length=206) Species: 331112 (Escherichia coli HS)

HNVDHEEIAKFEAVASRWWDLEGEFKPLHRINPLRLGYIAERAGGLFGKK
VLDVGCGGGILAESMAREGATVTGLDMGFEPLQVAKLHALESGIQVDYVQ
ETVEEHAAKHAGQYDVVTCMEMLEHVPDPQSVVRACAQLVKPGGDVFFST
LNRNGKFIKPAELLGWVDQTSLKERHITGLHYNPITNTFKLGPGVDVNYM
LHTQNK

3D structure

• PDB: 5dpm Crystal structure of UbiG mutant in complex with SAH at 2.1 angstroms resolution
• Chain: A
• Resolution: 2.1 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.222: 2-polyprenyl-6-hydroxyphenol methylase.
  2.1.1.64: 3-demethylubiquinol 3-O-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SAH	A	I17 F20 W27 R44 G64 C65 D85 M86 M129 E130 M131	I8 F11 W18 R35 G55 C56 D76 M77 M120 E121 M122

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0008168 methyltransferase activity
• GO:0008425 2-polyprenyl-6-methoxy-1,4-benzoquinone methyltransferase activity
• GO:0010420 3,4-dihydroxy-5-polyprenylbenzoic acid O-methyltransferase activity
• GO:0061542 3-demethylubiquinol-n 3-O-methyltransferase activity
• GO:0102208 2-polyprenyl-6-hydroxyphenol methylase activity
• GO:1901611 phosphatidylglycerol binding

Biological Process

• GO:0006744 ubiquinone biosynthetic process
• GO:0032259 methylation
• GO:0042538 hyperosmotic salinity response

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0009898 cytoplasmic side of plasma membrane
• GO:0110142 ubiquinone biosynthesis complex

External links

• PDB: RCSB:5dpm, PDBe:5dpm, PDBj:5dpm
• PDBsum: 5dpm
• UniProt: P17993|UBIG_ECOLI Ubiquinone biosynthesis O-methyltransferase (Gene Name=ubiG)