Structure of PDB 5di3 Chain A

Receptor sequence
>5di3A (length=164) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]
EARILVLGLDNAGKTTILKALSEEDITTITPTQGFNIKSLSRDGFNLKIW
DIGGQKSIRPYWRNYFDQTDALIYVIDSADSKRLSESEFELTELLQEEKM
TGVPLLVFANKQDLVGALAADEIASTLDLTSIRDRPWQIQACSAKQGTGL
KEGMEWMMKQVKLE
3D structure
PDB5di3 A G-protein activation cascade from Arl13B to Arl3 and implications for ciliary targeting of lipidated proteins.
ChainA
Resolution2.5 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) D85
Catalytic site (residue number reindexed from 1) D70
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GNP A D25 N26 G28 K29 T30 T31 P46 T47 G68 G69 N125 K126 D128 L129 S158 A159 K160 D10 N11 G13 K14 T15 T16 P31 T32 G53 G54 N110 K111 D113 L114 S143 A144 K145
BS02 MG A T30 T47 T15 T32
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005525 GTP binding
Biological Process
GO:0015031 protein transport
GO:0051301 cell division
Cellular Component
GO:0000139 Golgi membrane
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005794 Golgi apparatus
GO:0005815 microtubule organizing center
GO:0005819 spindle
GO:0005856 cytoskeleton
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5di3, PDBe:5di3, PDBj:5di3
PDBsum5di3
PubMed26551564
UniProtA8ISN6|ARL3_CHLRE ADP-ribosylation factor-like protein 3 (Gene Name=ARL3)

[Back to BioLiP]