Structure of PDB 5dfc Chain A |
>5dfcA (length=109) Species: 9606 (Homo sapiens) [Search protein sequence] |
LSEQLKHCNGILKELLSKKHAAYAFPFYKPVDASALGLHDYHDIIKHPMD LSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDV FEFRYAKMP |
|
PDB | 5dfc New Synthetic Routes to Triazolo-benzodiazepine Analogues: Expanding the Scope of the Bump-and-Hole Approach for Selective Bromo and Extra-Terminal (BET) Bromodomain Inhibition. |
Chain | A |
Resolution | 1.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
EAM |
A |
P371 L383 N429 V435 M438 |
P26 L38 N84 V90 M93 |
BindingDB: IC50=32.5nM,Ki=74nM,Kd=100nM |
|
|