Structure of PDB 5de3 Chain A

Receptor sequence
>5de3A (length=166) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]
ARILVLGLDNAGKTTILKALSEEDITTITPTQGFNIKSLSRDGFNLKIWD
IGGQKSIRPYWRNYFDQTDALIYVIDSADSKRLSESEFELTELLQEEKMT
GVPLLVFANKQDLVGALAADEIASTLDLTSIRDRPWQIQACSAKQGTGLK
EGMEWMMKQVKLEHHH
3D structure
PDB5de3 The Crystal structure of Chlamydomonas reinhardtii Arl3 bound to GppNHp
ChainA
Resolution1.417 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) Q70
Catalytic site (residue number reindexed from 1) Q54
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GNP A N26 G28 K29 T30 T31 T47 N125 K126 D128 L129 S158 N10 G12 K13 T14 T15 T31 N109 K110 D112 L113 S142
BS02 MG A T30 T47 T14 T31
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005525 GTP binding
Biological Process
GO:0015031 protein transport
GO:0051301 cell division
Cellular Component
GO:0000139 Golgi membrane
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005794 Golgi apparatus
GO:0005815 microtubule organizing center
GO:0005819 spindle
GO:0005856 cytoskeleton
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5de3, PDBe:5de3, PDBj:5de3
PDBsum5de3
PubMed
UniProtA8ISN6|ARL3_CHLRE ADP-ribosylation factor-like protein 3 (Gene Name=ARL3)

[Back to BioLiP]