Structure of PDB 5dah Chain A

Receptor sequence

>5dahA (length=179) Species: 9606 (Homo sapiens) [Search protein sequence]

MIGGCCVCSDERGWAENPLVYCDGHGCSVAVHQACYGIVQVPTGPWFCRK
CESQERAARVRCELCPHKDGALKRTDNGGWAHVVCALYIPEVQFANVSTM
EPIVLQSVPHDRYNKTCYICDEQGRESKAATGACMTCNKHGCRQAFHVTC
AQFAGLLCEEEGNGADNVQYCGYCKYHFS

3D structure

PDB

5dah The PZP Domain of AF10 Senses Unmodified H3K27 to Regulate DOT1L-Mediated Methylation of H3K79.

Chain

Resolution

2.611 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	A	A54 C55 L107 P110 V112 F114 V117 M120 E179 D186 N187 V188 Y190	A34 C35 L87 P90 V92 F94 V97 M100 E159 D166 N167 V168 Y170
BS02	ZN	A	C25 C28 H52 C55	C5 C8 H32 C35
BS03	ZN	A	C42 C47 C68 C71	C22 C27 C48 C51
BS04	ZN	A	C82 C85 H102 C105	C62 C65 H82 C85
BS05	ZN	A	C137 C140 H167 C170	C117 C120 H147 C150
BS06	ZN	A	C157 C162 C194 H197	C137 C142 C174 H177

External links

PDB	RCSB:5dah, PDBe:5dah, PDBj:5dah
PDBsum	5dah
PubMed	26439302
UniProt	P55197\|AF10_HUMAN Protein AF-10 (Gene Name=MLLT10)

[Back to BioLiP]