Structure of PDB 5d9i Chain A |
>5d9iA (length=133) [Search protein sequence] |
GSKVEDPKDFPSELLSFLSHAVFSNRTLACFAIYTTKEKAALLYKKIMEK YSVTFISRHNSYNHNILFFLTPHRHRVSAINNYAQKLCTFSFLICKGVNK EYLMYSALTRDPFSVIEESLPGGLKEHDFNPES |
|
PDB | 5d9i Structure-based analysis of the interaction between the simian virus 40 T-antigen origin binding domain and single-stranded DNA. |
Chain | A |
Resolution | 1.7 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
A |
R154 T155 R202 |
R26 T27 R74 |
|
|
|
|