Structure of PDB 5d75 Chain A

Receptor sequence

>5d75A (length=120) Species: 9606 (Homo sapiens)

PKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKN
AKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKI
PPNAKLTFEVELVDIDLEHH

3D structure

• PDB: 5d75 Crystal structure of the FK506 binding domain of human FKBP25 in complex with FK506.
• Chain: A
• Resolution: 1.83 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Y135 F145 D146 I172 Y198 F216
• Catalytic site (residue number reindexed from 1): Y27 F37 D38 I64 Y90 F108
• Enzyme Commision number: 5.2.1.8: peptidylprolyl isomerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FK5	A	Y135 D146 L162 K170 V171 I172 W175 Y198 Q203 A206	Y27 D38 L54 K62 V63 I64 W67 Y90 Q95 A98	MOAD: Ki=200nM PDBbind-CN: -logKd/Ki=6.70,Ki=200nM
BS02	JEF	A	G169 K170	G61 K62
BS03	JEF	A	P194 E195 G199 K200 K201 N211	P86 E87 G91 K92 K93 N103

Gene Ontology

Molecular Function

• GO:0003755 peptidyl-prolyl cis-trans isomerase activity

External links

• PDB: RCSB:5d75, PDBe:5d75, PDBj:5d75
• PDBsum: 5d75
• PubMed: 26749369
• UniProt: Q00688|FKBP3_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP3 (Gene Name=FKBP3)